DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG33127

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:257 Identity:71/257 - (27%)
Similarity:105/257 - (40%) Gaps:40/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VVGGNDADRFAN-PWMV---MVLGENNVFCSGSLITRLFVLTSASCLLSL--------PKQVILG 109
            ::.|.|.....| |::|   :........|..|:|.:.::||:|.|:..|        ...|..|
  Fly    41 IIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAG 105

  Fly   110 EYDR-NCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQ 173
            ..:| |.|:|      ||..:|....|..|. ......:||||.:::....:..|:.|.|. |..
  Fly   106 IINRSNVTAA------QVRYVDFASTHRSFN-GNAGSDNIALLHVSESFEYNARVQQIALP-DIN 162

  Fly   174 VGRSVQHFTATGWGTT--EWNEPSTILQTVTLSKINRKYCKGRLRQN--IDASQLCVGGPRKDTC 234
            ...|.:...|.|||.|  :.:|.|..||......:|...||..|..:  :.|.|:|   .:..||
  Fly   163 DDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVC---SQVKTC 224

  Fly   235 SGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIG---VYTNVEHYMDWIVRTI 293
            .||.|.||..         |.....|.|:|:.|:....|....   |||:|..|:.||.:||
  Fly   225 YGDGGTPLIY---------WPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 67/251 (27%)
Tryp_SPc 57..292 CDD:238113 69/254 (27%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 69/254 (27%)
Tryp_SPc 41..273 CDD:214473 67/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.