DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG31205

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:115/283 - (40%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TTRHPSRIRRVVG-----------GND---ADRFANPWMVMVL-----GENNVFCSGSLITRLFV 92
            ||.||:.....||           .:|   |:...:||:|.::     |.|.:.|:|.||....|
  Fly    14 TTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRV 78

  Fly    93 LTSASCLLSLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKY--DIALLRLAK 155
            :|:|.|:.....:.|.|....:..|::...:..|      .:|..:   :.:|:  |:|::.|.|
  Fly    79 VTAAHCVSKDESESIYGVVFGDSDSSNINLVSAV------TVHPDY---SPRKFENDLAIIELTK 134

  Fly   156 KVSISDYVRPICL-SVDRQV---GRSVQHFTATGWGTTEWNEPSTILQ------TVTLSKINRKY 210
            :|..||.|:|||| ||...|   ..|.......|.....::...:..|      .:|.:||:.|.
  Fly   135 EVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKE 199

  Fly   211 CKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAF-LIGIVSYG--SSS 272
            |..:..:          .|.:..|......|||.:...:..|    ..|.| |:||...|  ||.
  Fly   200 CHEKQAR----------FPEELICGHTERSPLSGSALTEASG----TPRQFHLLGIAVAGFFSSD 250

  Fly   273 CSGIGVYTNVEHYMDWIVRTINK 295
            ....| |.|:..::|||.:..:|
  Fly   251 LDHQG-YLNIRPHLDWISKNSSK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 64/266 (24%)
Tryp_SPc 57..292 CDD:238113 66/268 (25%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.