DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Habp2

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:278 Identity:88/278 - (31%)
Similarity:126/278 - (45%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NDCGTTRHPSR-IRRVVGGNDADRFANPWMV-----------MVLGENNVFCSGSLITRLFVLTS 95
            :.||.|..... ::|:.||..:....:||.|           |..|.   ||.||||...:|||:
  Rat   297 DSCGKTEMTEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGH---FCGGSLIHPCWVLTA 358

  Fly    96 ASCLLSLPK--QVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFG-LETVKKYDIALLRLAKKV 157
            |.|.....|  :|:||:.|...|.    |..|...:::.:.:.|:. .:.:...|||||:| |.|
  Rat   359 AHCTDMSTKHLKVVLGDQDLKKTE----SHEQTFRVEKILKYSQYNERDEIPHNDIALLKL-KPV 418

  Fly   158 S-----ISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGR--L 215
            .     .|.||:.:||..|.....:..|.  :|||.||..|.|..|....:..|....|..|  .
  Rat   419 GGHCALESKYVKTVCLPSDPFPSGTECHI--SGWGVTETGEGSRQLLDAKVKLIANALCNSRQLY 481

  Fly   216 RQNIDASQLCVGG---PRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIG 277
            ...||.|.:|.|.   |..|||.||:||||:    .:.||.:      ::.||||:|.......|
  Rat   482 DHTIDDSMICAGNLQKPGSDTCQGDSGGPLT----CEKDGTY------YVYGIVSWGQECGKKPG 536

  Fly   278 VYTNVEHYMDWIVRTINK 295
            |||.|..:::||..|::|
  Rat   537 VYTQVTKFLNWIKTTMHK 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 81/256 (32%)
Tryp_SPc 57..292 CDD:238113 82/258 (32%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056
Tryp_SPc 312..551 CDD:238113 82/258 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.