DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Gzmk

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:304 Identity:78/304 - (25%)
Similarity:122/304 - (40%) Gaps:76/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NNSVEFLIAYIYVNTYIFVAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRF 66
            ::::.||:|.||:::..|..||                                  :||.:....
  Rat     5 SSALVFLVAGIYMSSESFHTEI----------------------------------IGGREVQPH 35

  Fly    67 ANPWMVMVLGENNVFCSGSLITRLFVLTSASCL-LSLPKQVILGEYDRNCTSADCTSIRQVIDID 130
            :.|:|..:.......|.|.||...:|||:|.|. ......|:||.:..:...    .::|..:|.
  Rat    36 SRPFMASIQYRGKHICGGVLIHPQWVLTAAHCYSRGHSPTVVLGAHSLSKNE----PMKQTFEIK 96

  Fly   131 QKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQV--GRSVQHFTATGWGTTEWN- 192
            :.|....|...|   .||.|::|.....::.:|:.:.|.....:  |...|   .||||:|:.: 
  Rat    97 EFIPFSGFKSGT---NDIMLIKLRTAAELNKHVQLLHLRSKNYIRDGTKCQ---VTGWGSTKPDV 155

  Fly   193 -EPSTILQTVTLSKINRKYCKGRLRQN----IDASQLCVGGPR--KDTCSGDAGGPLSLTLKIDG 250
             ..|..||.||::.|:||.|..:...|    |....:|.|..|  ||:|.||:||||.       
  Rat   156 LTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITKDMICAGDRRGEKDSCKGDSGGPLI------- 213

  Fly   251 DGKWNNKSRAFLIGIVSYGSSSCSGI----GVYTNV-EHYMDWI 289
                   .:.....:|| |...| ||    ||||.: :.|..||
  Rat   214 -------CKGVFHALVS-GGYKC-GISNKPGVYTLLTKKYQTWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 68/248 (27%)
Tryp_SPc 57..292 CDD:238113 70/249 (28%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 70/282 (25%)
Tryp_SPc 26..251 CDD:238113 71/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.