DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG18420

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:289 Identity:94/289 - (32%)
Similarity:141/289 - (48%) Gaps:31/289 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFVAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRI-RRVVGGNDADRFANPWMVMVLGENNVF 81
            |.:|.|:||  |.:...|||:..|.::|| ||.|.:: .|:|.|..|.|.::|||..:...:|.|
  Fly     6 IGMASILLL--LTVFPLLGSTQFLDSECG-TRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQF 67

  Fly    82 -CSGSLITRLFVLTSASCLLSLPKQVI---LGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLET 142
             |.|:||:|..|||:|.|.  :|...|   ||||:|.     ....|:...:::...| :|....
  Fly    68 ICGGTLISRRLVLTAAHCF--IPNTTIVVRLGEYNRK-----LKGYREEHQVNRTFQH-RFYDPN 124

  Fly   143 VKKYDIALLRLAKKVSISDYVRPICLSVDRQVGR---SVQHFTATGWGTTEWNEPSTILQTVTLS 204
            ....|||||||...|.....:||||:..|.....   |::..|.||||.||....|:.|:|:.:|
  Fly   125 THANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDIS 189

  Fly   205 KINRKYCK-GRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSY 268
            :...|.|. |.:..|    |.|.|....:.|.||.|||:...:      ::.|..|...:|| :.
  Fly   190 RQPSKMCAFGSVLSN----QFCAGNWNSNLCIGDTGGPVGAMV------RYRNAFRFVQVGI-AI 243

  Fly   269 GSSSCSGIGVYTNVEHYMDWIVRTINKSN 297
            .:..|....|:|:|..::::|.|.....|
  Fly   244 TNKRCQRPSVFTDVMSHIEFIRRIFLTQN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 76/240 (32%)
Tryp_SPc 57..292 CDD:238113 76/242 (31%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 76/240 (32%)
Tryp_SPc 43..267 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.