DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG33226

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:281 Identity:106/281 - (37%)
Similarity:143/281 - (50%) Gaps:27/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLASLVLGAR----LGSSTLLTNDCGTTRHPSRIR-RVVGGNDADRFANPWMVMVLGENNVFCSG 84
            ||...:|..|    ||.. ||..:|..|  |..:| :::||::||...:||||.:|.....||.|
  Fly    13 LLVCFILALRSYESLGQD-LLDPNCVQT--PVGVREQILGGHNADIKLHPWMVQILQRGYHFCGG 74

  Fly    85 SLITRLFVLTSASCLLSLPKQVILGEYD-----RNCTSADCTSIRQVIDIDQKIIHGQFGLETVK 144
            |||:.|||||:|.|......:|..|.|.     ..|:|..|:.....||:.:..:|..:  ....
  Fly    75 SLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY--RDYH 137

  Fly   145 KYDIALLRLAKKVSISDYVRPICL----SVD--RQVGRSVQHFTATGWGTTEWNEPSTILQTVTL 203
            .|||||..|||.|..:...||||:    :.|  ||....|..|..||||.||....||||||.:|
  Fly   138 NYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSL 202

  Fly   204 SKINRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSY 268
            ..::||:|.....:.|....:|.|..:..||:||:|||||..|...|      ..|..|.||:||
  Fly   203 FHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSG------VKRTVLFGIISY 261

  Fly   269 GSSSCSGIGVYTNVEHYMDWI 289
            |:.:|..:.|:|||..|.:||
  Fly   262 GAPNCREVTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 92/243 (38%)
Tryp_SPc 57..292 CDD:238113 94/244 (39%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 94/244 (39%)
Tryp_SPc 47..282 CDD:214473 92/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472842
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.