DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Prss45

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:291 Identity:80/291 - (27%)
Similarity:123/291 - (42%) Gaps:49/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IVLLASLVLGAR--LGSSTLLTND-CGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSG 84
            |...|.|:|..|  ||.:...|.. |||...|..:.        :....||...:..|:...|.|
Mouse    21 ICFAALLLLPPRPNLGYNENYTEPVCGTPWWPDNLE--------ESHHWPWEASLQIEDKHVCGG 77

  Fly    85 SLITRLFVLTSASCLLSLPK-QVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDI 148
            :||.|.:|:::|.|:....: .|:||....:...:..|....|.||   |||.::......:.||
Mouse    78 ALIDRSWVVSAAHCIQGNKEYSVMLGSSTLHPNGSSWTLKIPVGDI---IIHPKYWGRNFIRSDI 139

  Fly   149 ALLRLAKKVSISDYVRPICL---SVDRQVGRSVQHFTATGWGTTEWNE-----PSTILQTVTLSK 205
            |||.|...|:.:.||:||||   :.:.:||...   ..||||..:.:.     |:..|....:..
Mouse   140 ALLCLETPVTFNKYVQPICLPEHNFNFKVGTKC---WVTGWGQVKQHSSAQLTPAPELWEAEVFI 201

  Fly   206 INRKYCKGRLRQN---------IDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAF 261
            |:.|.|.....:.         |..:.:|.....:|.|.||.||||:..:    ||:|      .
Mouse   202 IDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLCYGDPGGPLACEI----DGRW------I 256

  Fly   262 LIGIVSYGSSSCS---GIGVYTNVEHYMDWI 289
            |.|:.|: ..:|:   .:.|||.:..|..||
Mouse   257 LAGVFSW-EKACATVPNLSVYTRITKYTIWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 66/253 (26%)
Tryp_SPc 57..292 CDD:238113 68/254 (27%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 68/245 (28%)
Tryp_SPc 59..286 CDD:214473 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.