DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG30289

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:276 Identity:106/276 - (38%)
Similarity:147/276 - (53%) Gaps:17/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGS 85
            |.|..|..|.:......|.||..:||.::....:..:.||...:...|||||:|.....  |.||
  Fly     6 AVIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP--CGGS 68

  Fly    86 LITRLFVLTSASCLLSLPKQVILGEYDR-----NCTSADCTSIRQVIDIDQKIIHGQFGLETVKK 145
            ||.|.||||:|.|:......|.||:|:.     .|.:..|......|.:|.||:|..:...|::.
  Fly    69 LIARQFVLTAAHCVSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQN 133

  Fly   146 YDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKY 210
             ||||||:::.|..|||||||||.|..|: :|:..||.||||.||:.:.|.||...||..::..|
  Fly   134 -DIALLRMSEAVEYSDYVRPICLLVGEQM-QSIPMFTVTGWGETEYGQFSRILLNATLYNMDISY 196

  Fly   211 CKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSG 275
            |..:..:..|.||:|.|....:||.||:|||||...      .:.|:..:|..|:|||||..|:.
  Fly   197 CNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKF------HYGNRLLSFQYGLVSYGSERCAA 255

  Fly   276 --IGVYTNVEHYMDWI 289
              .||||||.::.:||
  Fly   256 NVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 95/239 (40%)
Tryp_SPc 57..292 CDD:238113 97/240 (40%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 95/238 (40%)
Tryp_SPc 42..271 CDD:238113 95/238 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472852
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.