DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG30288

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:289 Identity:115/289 - (39%)
Similarity:156/289 - (53%) Gaps:22/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VAEIVLLASLVLG-ARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCS 83
            :.::|::|.|.:| .|..|..||.||||||.......|:.||.||...:|||||.|:......|.
  Fly     5 IRQLVIVACLFIGIIRTESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCG 69

  Fly    84 GSLITRLFVLTSASCLLSLPKQVILGEYDR-----NCTSADCTSIRQVIDIDQKIIHGQFGLETV 143
            |||||..||||:..|:..:...|.|||||.     :|....||.....:|:|:||:|...|    
  Fly    70 GSLITARFVLTAEHCISPMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPG---- 130

  Fly   144 KKYDIALLRLAKKVSISDYVRPICLSVDRQVG---RSVQHFTATGWGTTEWNEPSTILQTVTLSK 205
              |||.|||:.:.|..|:|||||||.:.:.:|   .|:..|..|||||....|....|||.||.:
  Fly   131 --YDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQ 193

  Fly   206 INRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGS 270
            :.:..|: |..:.:|.|.:|.|....|:|.||:|||||.....:|.|      |.|..|:.|.|.
  Fly   194 LPQWSCE-RPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQG------RVFQFGVASQGL 251

  Fly   271 SSCSGIGVYTNVEHYMDWIVRTINKSNTE 299
            ..|||:|:||||.|:.|||:..|...:.:
  Fly   252 RLCSGLGIYTNVTHFTDWILDVIQNHSDD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 98/240 (41%)
Tryp_SPc 57..292 CDD:238113 99/242 (41%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 98/240 (41%)
Tryp_SPc 45..270 CDD:238113 97/237 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472835
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.