DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG30286

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:293 Identity:82/293 - (27%)
Similarity:140/293 - (47%) Gaps:38/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IVLLASLVLGARLGSSTLLTNDCG--------TTRHPSRIRRVVGGNDADRFANPWMVMVLGENN 79
            |:||.||:......::..|..|||        ...|.:.|..           :|||..:.....
  Fly     4 ILLLTSLLPWHPHATAQFLEPDCGYMSPEALQNEEHQAHISE-----------SPWMAYLHKSGE 57

  Fly    80 VFCSGSLITRLFVLTSASCLLSLPKQVI-LGEYDR----NCTSADCTSIRQVIDIDQKIIHGQFG 139
            :.|.|:|:...|:||:|.|:.......: |||::.    :|..:||....:..:||....||.:.
  Fly    58 LVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYS 122

  Fly   140 LETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQ---HFTATGWGTTEWNEPSTILQTV 201
             .|.:.:||.||||||.|....:::||||..:..:...::   ...|||||.:.....:.||:::
  Fly   123 -RTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSI 186

  Fly   202 TLSKINRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFL--IG 264
            .::::|...|......:....|:||......:||||:|||:...:::||        |...  :|
  Fly   187 RVTRVNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDG--------RVLFVQVG 243

  Fly   265 IVSYGSSSCSGIGVYTNVEHYMDWIVRTINKSN 297
            |||||::.|....|:|||..::|||:..::.::
  Fly   244 IVSYGNAECLSPSVFTNVMEHIDWIMAALSTTH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 69/242 (29%)
Tryp_SPc 57..292 CDD:238113 71/244 (29%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 72/249 (29%)
Tryp_SPc 39..268 CDD:214473 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.