DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG30187

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:269 Identity:93/269 - (34%)
Similarity:146/269 - (54%) Gaps:20/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCL 99
            :|:|..|...||.    :...::.||::|....:.||..|....:..|.|:||.:.||||:|.|:
  Fly    18 VGASIFLDQICGI----NIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCI 78

  Fly   100 LSLPKQ-VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYV 163
            :....| |.||.|::: ..||    |:  |:...::|..|.:....:.||.||:|:..|..:..:
  Fly    79 VDQDVQSVSLGAYNKS-DPAD----RK--DVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALI 136

  Fly   164 RPICLSVDRQVG---RSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLC 225
            ||||:.:::.:.   |:::.|.|.||||...|:.|.||||:.|:.::|:.|...|.......|:|
  Fly   137 RPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQIC 201

  Fly   226 VGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIGVYTNVEHYMDWIV 290
            .|.|..|||.||:||||:..:.|.|.|     :|....||:|.|.:||.|.||||::..:.|||.
  Fly   202 AGVPSGDTCGGDSGGPLTNDVFIQGIG-----NREVQFGIISVGKTSCDGQGVYTDLMSFADWIK 261

  Fly   291 RTINKSNTE 299
            .||.:.:.|
  Fly   262 MTIERLSIE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 83/236 (35%)
Tryp_SPc 57..292 CDD:238113 85/238 (36%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 83/236 (35%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.