DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG30082

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:280 Identity:103/280 - (36%)
Similarity:149/280 - (53%) Gaps:18/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFVAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFC 82
            :::|....|..|....|   :..:..:||||.:.....|:|||..||..:|||:..:...:::.|
  Fly     4 LWIASFAFLVCLTPKLR---AQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVC 65

  Fly    83 SGSLITRLFVLTSASCLLSLPKQVI-LGEYDR----NCTSADCTSIRQVIDIDQKIIHGQFGLET 142
            :|:|||:.||||:|.||.|.....: |||||.    :|||..|....:...::...||..||...
  Fly    66 TGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQ 130

  Fly   143 VKKYDIALLRLAKKVSISDYVRPICLSVD-RQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKI 206
            ..:.||.||:|...|....::|||||..| .||..| ..:.|.|||..:....:|:||||.|.::
  Fly   131 DSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYS-STYEAAGWGKIDLINTATVLQTVNLIRL 194

  Fly   207 NRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNK-SRAFLIGIVSYGS 270
            ::..|:..||.::...|.|.|..|.||||||:|||||..:.       |.: :|...:||||||.
  Fly   195 DQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMS-------NGRITRTVQLGIVSYGH 252

  Fly   271 SSCSGIGVYTNVEHYMDWIV 290
            ..|.|.||||.|..:.:||:
  Fly   253 YLCRGPGVYTYVPSFTNWIL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 93/239 (39%)
Tryp_SPc 57..292 CDD:238113 94/241 (39%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 93/239 (39%)
Tryp_SPc 40..274 CDD:238113 94/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.