DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Mst1

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:270 Identity:65/270 - (24%)
Similarity:111/270 - (41%) Gaps:54/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGTTRHPSRIRRVVGGNDADRFANPWMVMVLG-ENNVFCSGSLITRLFVLTSASCLLSLPK---- 104
            ||.....|...|||||:..:   :||.|.:.. :...||.|||:...:|||:..|:.|...    
  Rat   508 CGKRVDQSNRLRVVGGHPGN---SPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCIWSCHDPLTG 569

  Fly   105 -QVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICL 168
             :|.||..::|....:....|..:   .|.:.|..|.:.|      ||:|.:.|.::.:|..|||
  Rat   570 YEVWLGTINQNPQPGEANLQRVSV---AKTVCGPAGSQLV------LLKLERPVILNHHVARICL 625

  Fly   169 SVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLCVGGPRKDT 233
            ..::.|.....:....|||.::....||:|....:..|:.:.|..:.|:.:..|::|..|....|
  Rat   626 PPEQYVVPPGTNCEIAGWGESKGTSNSTVLHVAKMKVISSQECNVKYRRRVQESEICTEGLLAPT 690

  Fly   234 --CSGDAGGPLS-------------LTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIGVYTNVE 283
              |.||.||||:             :..::....:|.                     .::|.|.
  Rat   691 GACEGDYGGPLACYTHDCWVLQGLIIPNRVCARPRWP---------------------AIFTRVS 734

  Fly   284 HYMDWIVRTI 293
            .::|||.:.:
  Rat   735 VFVDWINKVV 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 60/253 (24%)
Tryp_SPc 57..292 CDD:238113 61/255 (24%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527
Tryp_SPc 520..743 CDD:238113 61/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.