DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Habp2

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001316864.1 Gene:Habp2 / 226243 MGIID:1196378 Length:554 Species:Mus musculus


Alignment Length:276 Identity:85/276 - (30%)
Similarity:126/276 - (45%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGTTRHPSR-IRRVVGGNDADRFANPWMV-----------MVLGENNVFCSGSLITRLFVLTSAS 97
            ||.|..... ::|:.||..:....:||.|           |..|.   ||.|:||...:|||:|.
Mouse   295 CGKTEVAEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGH---FCGGALIHPCWVLTAAH 356

  Fly    98 C--LLSLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFG-LETVKKYDIALLRLAKKVS- 158
            |  :.:...:|:||:.|...|.    |..|...:::.:.:.|:. .:.:...|||||:| |.|. 
Mouse   357 CTDINTKHLKVVLGDQDLKKTE----SHEQTFRVEKILKYSQYNERDEIPHNDIALLKL-KPVGG 416

  Fly   159 ----ISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGR--LRQ 217
                .|.||:.:||..|.....:..|.  :|||.||..|.|..|....:..|....|..|  ...
Mouse   417 HCALESRYVKTVCLPSDPFPSGTECHI--SGWGVTETGEGSRQLLDAKVKLIANPLCNSRQLYDH 479

  Fly   218 NIDASQLCVGG---PRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIGVY 279
            .||.|.:|.|.   |..|||.||:||||:    .:.||.:      ::.||||:|.......|||
Mouse   480 TIDDSMICAGNLQKPGSDTCQGDSGGPLT----CEKDGTY------YVYGIVSWGQECGKKPGVY 534

  Fly   280 TNVEHYMDWIVRTINK 295
            |.|..:::||..|:::
Mouse   535 TQVTKFLNWIKTTMHR 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 79/256 (31%)
Tryp_SPc 57..292 CDD:238113 80/258 (31%)
Habp2NP_001316864.1 EGF_CA 67..103 CDD:238011
EGF_CA 150..182 CDD:238011
KR 187..271 CDD:238056
Tryp_SPc 308..547 CDD:238113 80/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.