DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG43335

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:283 Identity:92/283 - (32%)
Similarity:139/283 - (49%) Gaps:17/283 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIR-RVVGGNDADRFANPWMVMVLGENNVFCSG 84
            |.:|:::......|.|.|.||..:||....||..| |::||:||:..::|||..:..|.:.||:|
  Fly     5 AFLVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAG 69

  Fly    85 SLITRLFVLTSASCL-LSLPKQVILGEYDRNCTSAD---CTSIRQVIDIDQKIIHGQFGLETVKK 145
            :|||..||||:|.|: .|....|.||  ....|.:|   |....:...:...|.|..| ..::..
  Fly    70 TLITNQFVLTAAHCIEASKNLTVRLG--GSGLTRSDGSMCQITAEDYSVSMAIKHKYF-TPSIML 131

  Fly   146 YDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQH---FTATGWGTTEWNEPSTILQTVTLSKIN 207
            .|||::|||:.|...|::||||:.:|..|...::.   ..|||||..:......:||...::.:|
  Fly   132 NDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMN 196

  Fly   208 RKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSS 272
            |..|.......|...|:|.|....:||.||:||||...:...||      .|....||.|:|...
  Fly   197 RNVCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGD------LRFVQYGITSFGDIE 255

  Fly   273 CSGIGVYTNVEHYMDWIVRTINK 295
            |....:||::..|..||...:::
  Fly   256 CRSPSIYTDLSTYSGWINMVVSQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 78/239 (33%)
Tryp_SPc 57..292 CDD:238113 79/241 (33%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 78/239 (33%)
Tryp_SPc 42..275 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.