DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CLIPA8

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_311445.2 Gene:CLIPA8 / 1272532 VectorBaseID:AGAP010731 Length:369 Species:Anopheles gambiae


Alignment Length:295 Identity:92/295 - (31%)
Similarity:128/295 - (43%) Gaps:67/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLTND------CGTTRHPSRIRRVVGGNDADRFAN-PWMVMVLGENNVFCS-----------GSL 86
            |:||:      ||.:.....|.:|.|.....::.. ||:|.:|   ..|.|           |:|
Mosquito    97 LVTNNEPVEYGCGISNPGGLIYQVEGNRTYAQYGEFPWVVAIL---EAFYSSNEQQFTYVGGGTL 158

  Fly    87 ITRLFVLTSASCLLSLPKQVI-LGEYDRNCTSADCTSIRQVIDIDQKII-HGQF---GLETVKKY 146
            |...||:|:|.........|. .||:|.|  ..:....:|.||||:.|| |.::   ||..    
Mosquito   159 IHPRFVVTAAHIFNKTENLVASFGEWDMN--RDENVYPKQNIDIDRTIIVHPEYNSVGLLN---- 217

  Fly   147 DIALLRLAKKVSISDYVRPICL--SVDRQVGRSVQHFTATGWG----TTEWNEPSTILQTVTLSK 205
            ||||.:|.:.|....::|||||  ..||   ...|...:||||    |:.:   :.:|:.|.|..
Mosquito   218 DIALAQLKQNVVYDKHIRPICLPNPTDR---FDDQLCISTGWGIEALTSAY---ANVLKRVDLPV 276

  Fly   206 INRKYCKGRLRQ-------NIDASQLCVGGPR-KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAF- 261
            |.|..||....:       .:..|.||.||.. .|.|.||.|..|:..          |:|.|: 
Mosquito   277 IARASCKKLFAETRLGPFFRLHKSVLCAGGEEGADMCDGDGGSGLACP----------NESGAYV 331

  Fly   262 LIGIVSYGSSSC---SGIGVYTNVEHYMDWIVRTI 293
            |.||||:| .||   :..|.|.||..::.||..||
Mosquito   332 LAGIVSWG-LSCHQQNVPGAYVNVARFVTWINATI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 82/267 (31%)
Tryp_SPc 57..292 CDD:238113 84/269 (31%)
CLIPA8XP_311445.2 Tryp_SPc 127..364 CDD:238113 82/262 (31%)
Tryp_SPc 127..361 CDD:214473 80/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.