DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Gzmbl3

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001316809.1 Gene:Gzmbl3 / 120766154 RGDID:2320502 Length:248 Species:Rattus norvegicus


Alignment Length:267 Identity:75/267 - (28%)
Similarity:119/267 - (44%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLTNDCGTTRHPSRIRRVVGGNDADRFANPWM--VMVLGEN--NVFCSGSLITRLFVLTSASCLL 100
            |||.....|.....|   :||::|...:.|:|  :.::.|:  :..|.|.||...||||:|.||.
  Rat     7 LLTVSLAPTTEAGEI---IGGHEAKPHSRPYMAYLQIMDEDSGSTMCGGFLIQEDFVLTAAHCLG 68

  Fly   101 SLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKY--DIALLRLAKKVSISDYV 163
            | ...|.||.::    ..:...::|||.:.:.|.|..:   ..|||  ||.||:|..|...:..|
  Rat    69 S-KITVTLGAHN----IKEQEKMQQVIPVVKIIPHPAY---NSKKYSNDIMLLKLKSKAKRTRAV 125

  Fly   164 RPICLSVDRQVGRSVQHFTATGWGTT-EWNEPSTILQTVTLSKINRKYCKGRLRQNID-ASQLCV 226
            :.:.|.......:........|||.. ...:....||.|.|:....:.|:...::..: |:|:|.
  Rat   126 KTLSLPRSNFKVKPGDVCNVAGWGKLGPMGKFPDKLQEVELTVQEDQECETYFKKAYNKANQICA 190

  Fly   227 GGP--RKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIGVYTNVEHYMDWI 289
            |.|  ::.:..||:||||              ..:....|||:|||.:.|....:|.|..::.||
  Rat   191 GDPKIKRASFGGDSGGPL--------------VCKKVAAGIVAYGSKNGSAPEAFTKVSTFLSWI 241

  Fly   290 VRTINKS 296
            ..|:.||
  Rat   242 KETMKKS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 65/242 (27%)
Tryp_SPc 57..292 CDD:238113 67/244 (27%)
Gzmbl3NP_001316809.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.