powered by:
Protein Alignment CG33225 and PIK3IP1
DIOPT Version :9
Sequence 1: | NP_001286682.1 |
Gene: | CG33225 / 2768860 |
FlyBaseID: | FBgn0053225 |
Length: | 307 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_443112.2 |
Gene: | PIK3IP1 / 113791 |
HGNCID: | 24942 |
Length: | 263 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 20/69 - (28%) |
Similarity: | 26/69 - (37%) |
Gaps: | 14/69 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 RSVQHFTATGWGTTEWNEPSTILQTVTLSKI-NRKYCKGRLRQNIDASQLCVGGPRKDTC--SGD 237
|..|...|.|.....|.:..:.|.:..:|.. |..||: |.|.. ||...| ||:
Human 34 REDQTSPAPGLRCLNWLDAQSGLASAPVSGAGNHSYCR-----NPDED------PRGPWCYVSGE 87
Fly 238 AGGP 241
||.|
Human 88 AGVP 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165143060 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.