DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:257 Identity:78/257 - (30%)
Similarity:113/257 - (43%) Gaps:53/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPK----QVILG-----EYDR 113
            |||.::.....||...:...:...|.||||.:.:||::|.|......    .||||     :||.
Zfish   309 VGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTVILGPKTQNKYDP 373

  Fly   114 NCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSV 178
            :..|   .|::.||.      |..:...| ...||||:||:..::.:|.:||:||:.:..|..| 
Zfish   374 SRIS---RSVKAVIK------HPYYNPNT-NDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNS- 427

  Fly   179 QHFTATGWGTTEWNE-------PS-TILQTVTLSKINRKYCK-----GRLRQNIDASQLCVGGPR 230
               ....|.|| |..       || .|.|.|.:..|..:.|.     |.:..|:..:.|...|  
Zfish   428 ---DTESWITT-WRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAGLLKEG-- 486

  Fly   231 KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFL-IGIVSYGSSSCSG--IGVYTNVEHYMDWI 289
            ||.|.||:|||:.           :|:|..:: .||||:||.....  .||||.|..|.:||
Zfish   487 KDLCQGDSGGPMV-----------SNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 76/255 (30%)
Tryp_SPc 57..292 CDD:238113 78/257 (30%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 76/255 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.