DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and mst1

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_004915630.2 Gene:mst1 / 100494056 XenbaseID:XB-GENE-487985 Length:736 Species:Xenopus tropicalis


Alignment Length:280 Identity:68/280 - (24%)
Similarity:111/280 - (39%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GSSTLLTNDCGTTRHPSRIR-RVVGGNDADRFANPWMVMV---LGENNVFCSGSLITRLFVLTSA 96
            |:..::.:.||.....|..| |:|||...:   :||.|.:   .||:  ||.|||:...:|:::.
 Frog   484 GAENIVFDSCGKRNDRSSQRTRIVGGMPGN---SPWTVSLRNRQGEH--FCGGSLVKENWVISTR 543

  Fly    97 SCLLSLPK-----QVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKK 156
            .|..|...     |.::|...:|.:..|  ..||.:.| .||:.|.      ....:.:|:|.:.
 Frog   544 QCFSSCDADLSGYQAVMGTLFKNPSPDD--PDRQSVPI-SKIVCGP------SDSSLVMLKLERP 599

  Fly   157 VSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRLRQN--- 218
            |:::..|..|||..:|.:..........|||.|.......:|:......|:...|....|..   
 Frog   600 VTLNSRVALICLPPERYIVPEATKCEIAGWGDTGGTGHDNVLKIAIFHIISNDECNKNYRSQRNK 664

  Fly   219 -IDASQLCVGGPRKD--TCSGDAGGPLS-----------LTLKIDGDGKWNNKSRAFLIGIVSYG 269
             :| :::|......|  .|.||.||||:           :.:...|.||.|..:           
 Frog   665 VLD-NEMCTKPVPVDVGACEGDYGGPLACLTHDCWVLEGVIVPARGCGKKNQPA----------- 717

  Fly   270 SSSCSGIGVYTNVEHYMDWI 289
                    ::|.|..|:|||
 Frog   718 --------IFTRVSVYVDWI 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 61/257 (24%)
Tryp_SPc 57..292 CDD:238113 62/258 (24%)
mst1XP_004915630.2 PAN_AP_HGF 36..114 CDD:238532
KR 118..198 CDD:214527
KR 201..279 CDD:214527
KR 308..390 CDD:214527
KR 397..474 CDD:412161
Tryp_SPc 506..732 CDD:238113 62/258 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.