DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and zgc:153968

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:294 Identity:85/294 - (28%)
Similarity:124/294 - (42%) Gaps:42/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVCF--ILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQI--LQRGYHFCG 73
            |.||.  :|.|....||.|  ||. |.:.|  ::.:|:||..|.....||.|.|  :..|...||
Zfish     5 LAVCVAGVLLLNISGSLCQ--LDV-CGRAP--LKPRIIGGQTAMAGSWPWQVSIHYIPTGGLLCG 64

  Fly    74 GSLISSLFVLTAAHCHSRY---RLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRD 135
            |:||:..:||:||.|..:.   .|.|..|..|...|..:.:           ...:|..|..|..
Zfish    65 GTLINREWVLSAAQCFQKLTASNLVVHLGHLSTGDPNVIHN-----------PASQIINHPKYDS 118

  Fly   136 YHN-YDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTS--TIL 197
            ..| .||||..|:.||.:....:|:|:..:.:.      |...|:..:||||...:..|.  |.|
Zfish   119 ATNKNDIALLKLSTPVSFTDYIKPVCLTASGSS------LGKGAVSWITGWGSINTGGTQFPTTL 177

  Fly   198 QTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQ--SSTCTGDSGGPLSAELTFSGVKRTVLFGIIS 260
            |...:..:....|...:...|....||||.::  ...|.||.|||    |..:..::.:..||.|
Zfish   178 QEVKIPVVSNGDCKSAYGSLITDGMICAGPNEGGKGICMGDGGGP----LVHNSSEQWIQSGIAS 238

  Fly   261 YGAPNC---REVTVFTNVLRYSNWIRDIVHNFTP 291
            :|. .|   :...|||.|..|.:||:..:....|
Zfish   239 FGR-GCAQPKNPGVFTRVSEYESWIKSQISKDQP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 72/250 (29%)
Tryp_SPc 47..282 CDD:214473 70/247 (28%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 70/248 (28%)
Tryp_SPc 36..265 CDD:238113 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.