DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and zgc:123295

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:271 Identity:83/271 - (30%)
Similarity:121/271 - (44%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CVQTPVGVREQILGGHNADIKLHPWMVQILQRGY--HFCGGSLISSLFVLTAAHC--HSRYRLKV 96
            |.:.|:..:  |:||.||.....||.|.:....|  ||||||||:..:||:||||  .|...:.|
Zfish    27 CGRAPLNTK--IVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQDSIGTIMV 89

  Fly    97 RFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHN-YDIALFLLAKPVRYNVQTRPIC 160
            :.|         |.|....:|:.....|.::..|.:|.:..| .||||..|...|.:|....|:|
Zfish    90 KLG---------LQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVC 145

  Fly   161 VLQTSNKDKLRQFLNYVA--MFNVTGWGKTESQLTS--TILQTTSLFHLDRKFCAQIFDRKIGWP 221
            :....|        .|.|  :..||||||..|....  .|||...:..:....|.:.:..:|...
Zfish   146 LAAAGN--------TYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPGEITSN 202

  Fly   222 HICAG---HSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCRE---VTVFTNVLRYSN 280
            .||||   .....:|.||||||:   ::.:| .:.:..||:|:|. .|.|   ..|:..|.:|.:
Zfish   203 MICAGLLDQGGKDSCQGDSGGPM---VSRNG-SQWIQSGIVSFGR-GCAEPGYPGVYARVSQYQD 262

  Fly   281 WIRDIVHNFTP 291
            ||.....:..|
Zfish   263 WITSSTGSSNP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 80/252 (32%)
Tryp_SPc 47..282 CDD:214473 78/249 (31%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 78/252 (31%)
Tryp_SPc 36..264 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.