DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG18735

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:286 Identity:84/286 - (29%)
Similarity:132/286 - (46%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QDLLDP------------NCVQTPVG---VREQILGGHNADIKLHPWMVQILQRGYHFCGGSLIS 78
            |.:|.|            .|.:...|   .|.:|:||...::..:|||:.::..|..:||.||::
  Fly    50 QSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVN 114

  Fly    79 SLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEID--VKRIFLHSSY--RDYHNY 139
            ..:.||||||.:.:..::       ||.|.|..::..|.. ..:|  |.|:.:|..|  |::.: 
  Fly   115 DQYALTAAHCVNGFYHRL-------ITVRLLEHNRQDSHV-KIVDRRVSRVLIHPKYSTRNFDS- 170

  Fly   140 DIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFN-VTGWGK-TESQLTSTILQTTSL 202
            ||||....:|||..:...|:|:...|.        ||..... |||||. :|....|..||...:
  Fly   171 DIALIRFNEPVRLGIDMHPVCMPTPSE--------NYAGQTAVVTGWGALSEGGPISDTLQEVEV 227

  Fly   203 FHLDRKFC--AQIFDRKIGWPHICAGHSQ---SSTCTGDSGGPLSAELTFSGVKRTVLFGIISYG 262
            ..|.::.|  :...:.||....||||:.:   ..:|.||||||:  .:..|| ....|.||:|:|
  Fly   228 PILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPM--HVLGSG-DAYQLAGIVSWG 289

  Fly   263 ----APNCREVTVFTNVLRYSNWIRD 284
                .||.  ..|:|.|..:::||.:
  Fly   290 EGCAKPNA--PGVYTRVGSFNDWIAE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 78/253 (31%)
Tryp_SPc 47..282 CDD:214473 76/249 (31%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/250 (30%)
Tryp_SPc 83..314 CDD:238113 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.