DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG34458

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:271 Identity:76/271 - (28%)
Similarity:118/271 - (43%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLDPNCVQTPVGVREQ--ILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYR 93
            ||....|.:.:.|.|:  |:||..|.....|..|.:...|.|.|||||||...::|||||     
  Fly    14 LLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHC----- 73

  Fly    94 LKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYR-DYHNYDIALFLLAKPVRYN--VQ 155
               ..|:..|.....:.::...:..|...::.:..:|..|. ...::|::|..|:.||...  ||
  Fly    74 ---TMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQ 135

  Fly   156 TRPICVLQTSNKDKLRQFLNYVA--MFNVTGWGKTESQL-TSTILQTTSLFHLDRKFCAQ----- 212
            |     :|.::.|.     ||.|  |..::|:|.....| ....|:...:....|.:|..     
  Fly   136 T-----IQLADSDS-----NYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPG 190

  Fly   213 IFDRKIGWPHICAGH--SQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNC---REVTVF 272
            :.||.     :||||  .|.|:|.|||||||:.:        ..|||::|:|. .|   ....::
  Fly   191 LTDRM-----VCAGHPSGQVSSCQGDSGGPLTVD--------GKLFGVVSWGF-GCGAKGRPAMY 241

  Fly   273 TNVLRYSNWIR 283
            |.|....:||:
  Fly   242 TYVGALRSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 71/253 (28%)
Tryp_SPc 47..282 CDD:214473 69/250 (28%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 69/251 (27%)
Tryp_SPc 32..254 CDD:238113 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.