DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and zgc:112038

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:263 Identity:78/263 - (29%)
Similarity:120/263 - (45%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CVQTPVGVREQILGGHNADIKLHPWMVQI--LQRGYHFCGGSLISSLFVLTAAHCH---SRYRLK 95
            |.|.|:....   ||.:|.....||...|  :....|.||||||:..:||:||||.   :...:|
Zfish    27 CGQAPLNNNN---GGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITATANIK 88

  Fly    96 VRFGR--YSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY-RDYHNYDIALFLLAKPVRYNVQTR 157
            :..||  .:|..|..:..:           :.:|.:|..| ....|.||||..|:..|.:....|
Zfish    89 IFLGRQFQTGSNPNEISRT-----------LTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIR 142

  Fly   158 PICVLQTSNKDKLRQFLNYVAMFNVTGWGKTES---QLTSTILQTTSLFHLDRKFCAQIFDRKIG 219
            |:|:   ::.|.:  |......: :|||.|..|   |:|: :||...|..:....|...:...|.
Zfish   143 PVCL---ASADSV--FAGGTKSW-ITGWDKHRSSDIQVTN-VLQEVQLPVVSNTECNADYKGIIT 200

  Fly   220 WPHICAGHSQ--SSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNC---REVTVFTNVLRYS 279
            ...||||.::  ...|.||||||:.::   :| .|.:..||:|:|. .|   |...::|.|.:|.
Zfish   201 DNMICAGINEGGKDACQGDSGGPMVSQ---NG-SRWIQSGIVSFGR-ECGLPRYPGIYTRVSQYQ 260

  Fly   280 NWI 282
            :||
Zfish   261 SWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 75/252 (30%)
Tryp_SPc 47..282 CDD:214473 73/250 (29%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 73/248 (29%)
Tryp_SPc 37..263 CDD:238113 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.