DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and hgfa

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_005164799.1 Gene:hgfa / 493781 ZFINID:ZDB-GENE-041014-2 Length:712 Species:Danio rerio


Alignment Length:281 Identity:68/281 - (24%)
Similarity:97/281 - (34%) Gaps:75/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PNCVQTPVGVREQILGGHNAD-IKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYRLKVR 97
            |:|.   :....:|:||.... .:...|:|.|.:...|:||||||...:|||...|.|.      
Zfish   467 PSCF---IHKTTRIVGGMRVQRAEDGSWVVSIQKGNRHWCGGSLIREEWVLTDQQCFST------ 522

  Fly    98 FGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLH-------SSYRDYH------NYDIALFLLAKP 149
                             |.|...|..|:...||       .:.|..|      ..::||..|..|
Zfish   523 -----------------CVPDLSEYTVQVGLLHLNASAGTQALRIAHVVCGPEGSNLALLKLTTP 570

  Fly   150 VRYNVQTRPI------CVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRK 208
            ...:...|.:      |.:...            .:..:.|||.|:.......|:...|..:..|
Zfish   571 APLSEHVRTVQLPVAGCAVAEG------------TLCLMYGWGDTKGTGHEGSLKMVGLPIVSNK 623

  Fly   209 FCAQ-------IFDRKIGWPHICAGHSQ-SSTCTGDSGGPLSAELTFSGVKRTVL-FGIISYGAP 264
            .|:|       |.:.|     ||||..: ...|..|.||||..:   .|..:.:: ..|...|..
Zfish   624 RCSQSHNGILPITETK-----ICAGGKRDQGVCEKDYGGPLVCQ---EGESKVIVGVSINGRGCA 680

  Fly   265 NCREVTVFTNVLRYSNWIRDI 285
            ..|...||.||..||.|||.:
Zfish   681 VARRPAVFVNVAFYSEWIRKV 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 66/266 (25%)
Tryp_SPc 47..282 CDD:214473 63/263 (24%)
hgfaXP_005164799.1 PAN_AP_HGF <50..107 CDD:238532
KR 111..192 CDD:238056
KR 195..275 CDD:214527
KR 287..367 CDD:214527
KR 374..451 CDD:214527
Tryp_SPc 476..698 CDD:214473 63/264 (24%)
Tryp_SPc 477..701 CDD:238113 66/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.