DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and MST1

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:286 Identity:67/286 - (23%)
Similarity:98/286 - (34%) Gaps:85/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRY 92
            ||........|.||..||:                  |::|.|||||||:...::|||..|.|..
Human   507 GQSACGIGEAQLPVSHREE------------------LRQGQHFCGGSLVKEQWILTARQCFSSC 553

  Fly    93 RLKV--------------RFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIAL 143
            .:.:              :.|..|  ..|...:...|.|.|.:                   :.|
Human   554 HMPLTGYEVWLGTLFQNPQHGEPS--LQRVPVAKMVCGPSGSQ-------------------LVL 597

  Fly   144 FLLAKPVRYNVQTRPIC------VLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSL 202
            ..|.:.|..|.:...||      |:....|            ..:.|||:|:.....|:|....|
Human   598 LKLERSVTLNQRVALICLPPEWYVVPPGTK------------CEIAGWGETKGTGNDTVLNVALL 650

  Fly   203 FHLDRKFCAQIFDRKIGWPHICAGH--SQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPN 265
            ..:..:.|......::....:|...  :....|.||.||||:.   |:. ...||.|||   .||
Human   651 NVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLAC---FTH-NCWVLEGII---IPN 708

  Fly   266 --C---REVTVFTNVLRYSNWIRDIV 286
              |   |...|||.|..:.:||..::
Human   709 RVCARSRWPAVFTRVSVFVDWIHKVM 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 60/264 (23%)
Tryp_SPc 47..282 CDD:214473 58/261 (22%)
MST1NP_001380510.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143024
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.