DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG11313

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:276 Identity:93/276 - (33%)
Similarity:134/276 - (48%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QILGGHNADIKLHPWMVQILQRGYH------FCGGSLISSLFVLTAAHCHS----------RYRL 94
            ||..|:...:....|||.:..|.:.      :|.||||::.:|:|||||.|          .:|:
  Fly   115 QITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRV 179

  Fly    95 KVRFGRY--SGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY--RDYHNYDIALFLLAKPVRYNVQ 155
            .||.|.:  |.:..   |.:..|.|...:|.|:.|.:|.|:  |.:.| ||||..||:.|.|:..
  Fly   180 SVRLGEHNTSAVVD---CLNGRCLPEPVQIAVEEIRIHESFGTRLFWN-DIALIRLAREVAYSPS 240

  Fly   156 TRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRK--- 217
            .||:|:..|..   |:.:.:..| |.|.|||:|.:..:|.:.....:.:::...|.    ||   
  Fly   241 IRPVCLPSTVG---LQNWQSGQA-FTVAGWGRTLTSESSPVKMKLRVTYVEPGLCR----RKYAS 297

  Fly   218 ---IGWPHICA-GHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCRE---VTVFTNV 275
               :|..|:|| |.|:..:|.|||||||.|  ...||  .||.||:|:|. ||..   ..|:|||
  Fly   298 IVVLGDSHLCAEGRSRGDSCDGDSGGPLMA--FHEGV--WVLGGIVSFGL-NCGSRFWPAVYTNV 357

  Fly   276 LRYSNWIRDIVHNFTP 291
            |.|..|   |..|..|
  Fly   358 LSYETW---ITQNIRP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 89/267 (33%)
Tryp_SPc 47..282 CDD:214473 88/264 (33%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 90/270 (33%)
Tryp_SPc 116..364 CDD:214473 89/267 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.