DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG9733

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:301 Identity:97/301 - (32%)
Similarity:137/301 - (45%) Gaps:57/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RSYESLGQDLL--DPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYH------FCGGSLIS 78
            :|..|.|..||  .|:|  ..||:|.:|..|.:.|:...||||.:..|...      .|.||||:
  Fly   137 KSSTSDGSSLLPQPPSC--GGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLIN 199

  Fly    79 SLFVLTAAHC-HSRYR------LKVRFGRYSGITPRYLCSSQYCSPFG----PEID---VKRIFL 129
            ..:||||||| ..|..      :.||.|.:...|      :..|.|.|    ||:.   .:.|.:
  Fly   200 RRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRT------AVDCPPGGGSCSPEVQRLGFEEIRV 258

  Fly   130 HSSYRDYHN---YDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQ 191
            |..|.:..:   :||.|..:.:.|||:...:||| |.:|...:.||   ....|.|.|||:|...
  Fly   259 HERYSEKASNQVHDIGLIRMERNVRYSDNIQPIC-LPSSVGLESRQ---SGQQFTVAGWGRTLKM 319

  Fly   192 LTSTILQTTSLFHLDRKFCAQIFDR-KIGW--PHICA-GHSQSSTCTGDSGGPLSAELTFSGVKR 252
            ..|.:.|..::.::|...|.|.|.: |:..  ..:|| |..:..:|.|||||||   :.|.. :.
  Fly   320 ARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPL---MRFRD-ES 380

  Fly   253 TVLFGIISYGA-------PNCREVTVFTNVLRYSNWIRDIV 286
            .||.||:|:|.       |.     |:|||..|..|||..|
  Fly   381 WVLEGIVSFGYKCGLKDWPG-----VYTNVAAYDIWIRQNV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 86/271 (32%)
Tryp_SPc 47..282 CDD:214473 83/268 (31%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 83/269 (31%)
Tryp_SPc 162..415 CDD:238113 86/271 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.