DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG11836

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:258 Identity:79/258 - (30%)
Similarity:122/258 - (47%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYR---LKVRFGRYSGITPR 107
            :|:||....:..:|||.:|:..|...|||||::..:||:||||..:.|   ::|.||.:.   ..
  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHD---QE 157

  Fly   108 YLCSSQYCSPFGPEIDVKRIFLHSSY-RDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLR 171
            ....||     ..:..|..:..|.|: .|.:|.||||..|.||:.::...:||| |...|.|...
  Fly   158 ITSESQ-----AIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPIC-LPRYNYDPAG 216

  Fly   172 QFLNYVAMFNVTGWGKTE---------SQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGH 227
            :      :..|.|||:|.         :|:...|:..|...:...|      ..:|....:|||.
  Fly   217 R------IGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYK------STRITSSMLCAGR 269

  Fly   228 SQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCRE--VTVFTNVLRYSNWIRDIVHN 288
            ....:|.|||||||   |..:|||..:: ||:|:|....||  ..|::.|.::..||:..:.|
  Fly   270 PSMDSCQGDSGGPL---LLSNGVKYFIV-GIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLEN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 78/252 (31%)
Tryp_SPc 47..282 CDD:214473 76/249 (31%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.