DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG7142

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:109/277 - (39%) Gaps:71/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HNADIKLHPWMVQIL-----QRGYHFCGGSLISSLFVLTAAHCHS-------------RYRLKVR 97
            |:|     |::|.|.     |...|:|.|::|:..::||||||.|             .:.:..:
  Fly    89 HSA-----PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQ 148

  Fly    98 FGRYSGITPR----YLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVRYNVQTRP 158
            .|..|.|..|    |:....|.....|                  |||||....:|:.::...:|
  Fly   149 KGEASNIQMRHIDYYVRHELYLGGVNP------------------YDIALIYTKEPLVFDTYVQP 195

  Fly   159 ICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTI---LQTTSLFHLDRKFCAQIFDRKIGW 220
            ..:.:...:.:     .|..::   |||..........   ||..::..||.:.|.||..|. |.
  Fly   196 ATLPEQDAQPE-----GYGTLY---GWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARS-GL 251

  Fly   221 P----HICAGHSQS--STCTGDSGGPL---SAELTFSGVKRTVLFGIISYGAPNCRE---VTVFT 273
            |    ::|.|....  |.||.||||||   ..|..|.  :..::.||:|:|...|.:   .:||.
  Fly   252 PLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFE--QANIVIGIVSWGKMPCGQKNAPSVFV 314

  Fly   274 NVLRYSNWIRDIVHNFT 290
            .|..::.||..::...|
  Fly   315 RVSAFTEWINQVISTAT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 68/270 (25%)
Tryp_SPc 47..282 CDD:214473 66/267 (25%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 68/270 (25%)
Tryp_SPc 84..323 CDD:214473 66/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.