DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG31266

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:263 Identity:71/263 - (26%)
Similarity:108/263 - (41%) Gaps:51/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QILGGHNADIKLHPWMVQILQR-GYHFCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYL 109
            :::||..|.....||:..|... .||.||..::...:|||||.|            .:|:.|..|
  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASC------------VAGLRPLNL 103

  Fly   110 C----SSQYCSPFGPEIDVKRIFLHSSYRD--YHNYDIALFLLAKPVRYNVQTRPICVL---QTS 165
            .    :..:...:.|...|.:|.:|.::..  ||| ||||..|:..:.:|..|:.|.:.   :..
  Fly   104 LVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHN-DIALLQLSSKIEFNDVTKNITLADIDELE 167

  Fly   166 NKDKLRQFLNYVAMFNVTGWGKTESQLT-STILQTTSLFHLDRKFCAQIFDRK--IGWPHIC--- 224
            ..|||          ...|||.:|:..| ...||..|..:|....|.:....:  :...|:|   
  Fly   168 EGDKL----------TFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQM 222

  Fly   225 -AGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREV-TVFTNVLRYSNWIRDIVH 287
             ||   ...|.||:||||..|       :..|.||.::|.|..|.. .|:.....|.:|||..::
  Fly   223 DAG---QGACHGDTGGPLIDE-------QQRLVGIGNWGVPCGRGYPDVYARTAFYHDWIRTTMN 277

  Fly   288 NFT 290
            ..|
  Fly   278 GCT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 70/255 (27%)
Tryp_SPc 47..282 CDD:214473 67/252 (27%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 67/253 (26%)
Tryp_SPc 52..275 CDD:238113 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.