DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and ea

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:281 Identity:87/281 - (30%)
Similarity:135/281 - (48%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QILGGHNADIKLHPWMVQIL------QRGYHFCGGSLISSLFVLTAAHC------HSRYRLK-VR 97
            :|.||....|...|||..|.      ::|:| |||||||:.:|:||:||      .:.:||. ||
  Fly   127 RIYGGMKTKIDEFPWMALIEYTKSQGKKGHH-CGGSLISTRYVITASHCVNGKALPTDWRLSGVR 190

  Fly    98 FGRY-SGITPRYLC-----SSQYCSPFGPEIDVKRIFLHSSY----RDYHNYDIALFLLAKPVRY 152
            .|.: :...|.  |     ..:.|:|...::.|:|...|..|    ::..| ||||..||:.|.|
  Fly   191 LGEWDTNTNPD--CEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVN-DIALLRLAQQVEY 252

  Fly   153 NVQTRPICV-----LQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSL---FHLDRKF 209
            ....||||:     |:::..|.:        ..:|.|||||| ||:::.|:..:.   |.:|.  
  Fly   253 TDFVRPICLPLDVNLRSATFDGI--------TMDVAGWGKTE-QLSASNLKLKAAVEGFRMDE-- 306

  Fly   210 CAQIF---DRKIGWPHICAGHSQS-STCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREV- 269
            |..::   |..:....:|||..:. .:|.|||||||....|........|.|::|:|...|... 
  Fly   307 CQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAG 371

  Fly   270 --TVFTNVLRYSNWIRDIVHN 288
              .|:|.|.:|.:||::.:.:
  Fly   372 WPGVYTLVGKYVDWIQNTIES 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 87/275 (32%)
Tryp_SPc 47..282 CDD:214473 85/272 (31%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 85/273 (31%)
Tryp_SPc 128..389 CDD:238113 87/275 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.