DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG3916

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:294 Identity:79/294 - (26%)
Similarity:126/294 - (42%) Gaps:57/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVCFILALRSYESLGQDLLD--PNCVQTPVGVREQILGGHNADIKLHPWMV--QILQRG--YHFC 72
            |.|.:|.||      |.|.|  .:..::|.    :|.||...: :..|:.|  |:.:||  .|||
  Fly     6 LFCMLLILR------QGLADVVTSTTESPT----RINGGQRVN-ETVPFQVSLQMQRRGRWQHFC 59

  Fly    73 GGSLISSLFVLTAAHCHSRYRLK---VRFG----RYSGITPRYLCSSQYCSPFGPEIDVKRIFLH 130
            |||::|...|||||||..:.:::   |..|    :..|:..|.:....:     |:..:....::
  Fly    60 GGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRHRLVTKHVH-----PQYSMNPRIIN 119

  Fly   131 SSYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTST 195
                     ||||..:..|.|  ::...|..:.....|::.:    .....:||||.|....:|.
  Fly   120 ---------DIALVKVTPPFR--LERSDISTILIGGSDRIGE----KVPVRLTGWGSTSPSTSSA 169

  Fly   196 I----LQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQ-SSTCTGDSGGPLSAELTFSGVKRTVL 255
            .    ||..:...:..:.|.|...| :....|||...| ...|.|||||||     ....|:..|
  Fly   170 TLPDQLQALNYRTISNEDCNQKGFR-VTRNEICALAVQGQGACVGDSGGPL-----IRPGKQPHL 228

  Fly   256 FGIISYGAPNCRE--VTVFTNVLRYSNWIRDIVH 287
            .||:|||:..|.:  ..|:|.|..:..:|..:::
  Fly   229 VGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVIN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 70/255 (27%)
Tryp_SPc 47..282 CDD:214473 69/252 (27%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 69/253 (27%)
Tryp_SPc 31..260 CDD:238113 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.