DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG17404

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:113/265 - (42%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TPVGVREQILGGHNADI---KLHPWMV--QILQRG--YHFCGGSLISSLFVLTAAHC---HSRYR 93
            ||    .:|:||  |||   :..|:.|  |...||  .||||||:|:...:||||||   .:..|
  Fly    31 TP----HRIVGG--ADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASR 89

  Fly    94 LKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVRYNVQTRP 158
            :.|..| ..|:..:           |....|....:|..|::....|:|:..:..|::.|..|..
  Fly    90 MSVVAG-IRGLNEK-----------GSRSQVLSYSIHPKYQELVTSDLAVLSIKPPLKLNNSTIS 142

  Fly   159 ICVLQTSNKDKLRQFLNYVAMFNVTGWGK--------TESQLTSTILQTTSLFHLDRKFCAQIFD 215
            ....::..||    |:.......:||||.        .::.....:||..|...:....|.....
  Fly   143 AIEYRSQGKD----FVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGM 203

  Fly   216 RKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCR---EVTVFTNVLR 277
            ..:....|||.......|:|||||||..| :.:|:::.   ||:|||...|.   ...|:|.|..
  Fly   204 ESVTDTEICARGPFRGACSGDSGGPLVME-SKNGLQQV---GIVSYGLVVCGLYISPDVYTRVST 264

  Fly   278 YSNWI 282
            :|:||
  Fly   265 FSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 73/257 (28%)
Tryp_SPc 47..282 CDD:214473 71/255 (28%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 71/256 (28%)
Tryp_SPc 35..269 CDD:238113 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.