DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG10663

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:294 Identity:83/294 - (28%)
Similarity:128/294 - (43%) Gaps:46/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FILALRSYESLGQDLLDPNC--VQTPVGVRE-----QILGGHNADIKLHPWMVQILQRGYH-FCG 73
            :|:..:.|.......|..:|  |::..|.|.     :|:||..|.....||.|.||.|... |||
  Fly   470 YIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCG 534

  Fly    74 GSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY-RDYH 137
            |:||:..:||||||| .|..|.||.|.:         :..|......::.|.:.:.|.:: :...
  Fly   535 GTLIAPRWVLTAAHC-VRKVLFVRIGEH---------NLNYEDGTEIQLRVMKSYTHPNFDKRTV 589

  Fly   138 NYDIALFLLAKPVR------YNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQ-LTST 195
            :.|:||..|.|.|.      |:...:|...| ..|.|           ..:.||||..:: .|.|
  Fly   590 DSDVALLRLPKAVNATTWIGYSCLPQPFQAL-PKNVD-----------CTIIGWGKRRNRDATGT 642

  Fly   196 -ILQTTSLFHLDRKFCAQI-FDRKIGWPHICAGHSQS--STCTGDSGGPLSAELTFSGVKRTVLF 256
             :|...::..:..:.|.:: :|..|.....||||.:.  .||.|||||||....|........:|
  Fly   643 SVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIF 707

  Fly   257 GIISYGAPNC---REVTVFTNVLRYSNWIRDIVH 287
            ||.|:| ..|   .:..::..|..|.:|:..:|:
  Fly   708 GITSFG-DGCAQRNKFGIYAKVPNYVDWVWSVVN 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 75/253 (30%)
Tryp_SPc 47..282 CDD:214473 74/250 (30%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 74/251 (29%)
Tryp_SPc 507..735 CDD:238113 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.