DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and tpr

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:265 Identity:76/265 - (28%)
Similarity:125/265 - (47%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHC---HSRYRLKV 96
            :||.....::::|:||...::..:||:..:|..|..:|..||::..|:|||:||   ..:.|:.|
  Fly   115 DCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISV 179

  Fly    97 RFGRYSGITPRYLCSSQYCSPFGPEID--VKRIFLHSSY--RDYHNYDIALFLLAKPVRYNVQTR 157
            |...:.    |.:...|       :||  |..:..|..|  |:|.| |||:..|.:||.:|....
  Fly   180 RLLEHD----RKMSHMQ-------KIDRKVAEVITHPKYNARNYDN-DIAIIKLDEPVEFNEVLH 232

  Fly   158 PICVLQTSNKDKLRQFLNYVAMFNVTGWGKTE-SQLTSTILQTTSLFHLDRKFCAQI-FDRKIGW 220
            |:|:.......|....:       |||||..: ...||..||...:..|.:..|.:. :..||..
  Fly   233 PVCMPTPGRSFKGENGI-------VTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITD 290

  Fly   221 PHICAGHSQ--SSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREV---TVFTNVLRYSN 280
            ..:|.|:.:  ..:|.|||||||  .:..||.:...:.|::|:| ..|.:.   .|:..|.||..
  Fly   291 NMLCGGYDEGGKDSCQGDSGGPL--HIVASGTREHQIAGVVSWG-EGCAKAGYPGVYARVNRYGT 352

  Fly   281 WIRDI 285
            ||:::
  Fly   353 WIKNL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 74/251 (29%)
Tryp_SPc 47..282 CDD:214473 72/248 (29%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 72/249 (29%)
Tryp_SPc 127..356 CDD:238113 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.