DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG10764

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:264 Identity:91/264 - (34%)
Similarity:131/264 - (49%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VQTPVGV--REQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSR-YRLKVRF 98
            ::||.|:  |.:|.||.:|......||..|.......|||::|...|||:||||..| |.|.||.
  Fly    26 LETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYVRL 90

  Fly    99 GRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY--RDYHNYDIALFLLAKPVRYNVQTRPICV 161
            |..:...|..:.:            |..:|:|..:  .:|.| ||.|..|::.:.|.|:.:|||:
  Fly    91 GARNINEPAAVHT------------VINVFVHHDFIASEYRN-DIGLLQLSESIVYTVRVQPICI 142

  Fly   162 -LQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICA 225
             |..:.|..:.:    :..|...|||....:| |.:|||..|.||.|..|.:..:..:....|||
  Fly   143 FLDPALKGSVEK----LKTFRALGWGNRNGKL-SIMLQTIYLLHLKRNECKRKLNFNLNSRQICA 202

  Fly   226 GHSQSSTCTGDSGGPLSAELTF-SGVKRTVLFGIISYGAPNCREVTVFTNVLRYSNWIRDIV--H 287
            |.....||.||||||||..:.| |.....|..||:|:|.|.||.|.|:|:|..|.:||...:  :
  Fly   203 GTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTSYVDWISSTIARN 267

  Fly   288 NFTP 291
            ::.|
  Fly   268 DYLP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 86/242 (36%)
Tryp_SPc 47..282 CDD:214473 84/239 (35%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 84/240 (35%)
Tryp_SPc 38..263 CDD:238113 86/242 (36%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.