DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG8586

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:255 Identity:72/255 - (28%)
Similarity:110/255 - (43%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HNADIKL---HPWMVQILQRGYHF-CGGSLISSLFVLTAAH---CHSRYRLKVRFGRYSGITPRY 108
            ::.|:.:   .||||.|......| |||:||....|:|.:|   ..:...|..|.|.:.      
  Fly   189 YSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWD------ 247

  Fly   109 LCSSQYCSPF---GPEIDVKRIFLHSSYRDYHNY-DIALFLLAKPVRYNVQTRPICVLQTSNKDK 169
              .:....|:   |..|  |.|.:||.:.....| ||||.||.:|:|.....:|:|:....:.:.
  Fly   248 --LNSLNEPYPHQGSRI--KEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPEL 308

  Fly   170 LRQFLNYVAMFNVTGWGKTE--SQLTSTILQTTSLFHLDRKFC-AQIFDRKIGW------PHICA 225
            ..|.|:....  .||||..|  |.....:|:..:|..::|:.| |::.:.::..      ..|||
  Fly   309 TNQLLSVTCY--ATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICA 371

  Fly   226 GHSQ-SSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCRE--VTVFTNVLRYSNWI 282
            |... ..||.||.|.||..::. ..:.|..|.||:|:|.....|  ..|:.||.....||
  Fly   372 GGDPGKDTCKGDGGSPLFCQMP-GEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 72/255 (28%)
Tryp_SPc 47..282 CDD:214473 70/253 (28%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 71/247 (29%)
Tryp_SPc 197..430 CDD:214473 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.