DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG18478

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:323 Identity:89/323 - (27%)
Similarity:132/323 - (40%) Gaps:79/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WLLV--CFILA-------LRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQR 67
            |.|:  .|:|.       |:..|.|.....:|:.|:....|.|     ..|.....||.:.::..
  Fly     5 WTLIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQFNVTE-----GQAKPAEFPWTIAVIHN 64

  Fly    68 GYHFCGGSLISSLFVLTAAHCHSRYR--------LKVRFG--RYSGITPRYLCSSQYCSPFGPEI 122
            .....|||||:...||||||     |        :.|..|  .|.....:|        || .|.
  Fly    65 RSLVGGGSLITPDIVLTAAH-----RIFNKDVEDIVVSAGEWEYGSALEKY--------PF-EEA 115

  Fly   123 DVKRIFLHSSYRDYHNY-----DIALFLLAK--PVRYNVQTRPICVLQTSNKDKLRQFLNYVAMF 180
            .|.::.:|.|:    ||     ::||..|.:  |:.|.:.|  ||:  .:.|..|......||  
  Fly   116 FVLKMVIHKSF----NYQRGANNLALLFLDREFPLTYKINT--ICL--PTQKRSLSSTRCIVA-- 170

  Fly   181 NVTGWGKTESQLTST----ILQTTSLFHLDRKFCA-QIFDRKIGWPH------ICA-GHSQSSTC 233
               ||||  .|.:.|    :|:...|..:.|..|. |:...::|..:      ||| |...:..|
  Fly   171 ---GWGK--YQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDAC 230

  Fly   234 TGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREVTV---FTNVLRYSNWI-RDIVHN-FTP 291
            |||.||.|...:| ...|:....||:::|. .|:|..|   :|:|..:..|| :.|..| :||
  Fly   231 TGDGGGALFCPMT-EDPKQFEQIGIVNWGV-GCKEKNVPATYTDVFEFKPWIVQQIKENLYTP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 74/270 (27%)
Tryp_SPc 47..282 CDD:214473 72/266 (27%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 74/263 (28%)
Tryp_SPc 50..280 CDD:214473 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.