DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG5390

DIOPT Version :10

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_609374.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:296 Identity:83/296 - (28%)
Similarity:118/296 - (39%) Gaps:94/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QTPVGVREQILGGHN--ADIKLHPWMVQILQR----GYHFCGGSLISSLFVLTAAHC-HSRY--R 93
            |.|.||..:|.|..|  |:....|||:.||:.    ..:.|||:||:...||||||| |::.  .
  Fly   138 QNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSS 202

  Fly    94 LKVRFGRYSGIT--------PRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNY-DIALFLLAKP 149
            :.||.|.:...|        .||               ||.|..|..:.....| |:|:.||..|
  Fly   203 IVVRAGEWDTQTQTEIRRHEDRY---------------VKEIIYHEQFNKGSLYNDVAVMLLESP 252

  Fly   150 --VRYNVQTRPICVLQTSNK-DKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCA 211
              ::.|:||  :|:....:| |..|.:        .|||||.:             |..|.::  
  Fly   253 FTLQENIQT--VCLPNVGDKFDFDRCY--------ATGWGKNK-------------FGKDGEY-- 292

  Fly   212 QIFDRKIGWP-------------------------HICA-GHSQSSTCTGDSGGPLSAELTFSGV 250
            |:..:|:..|                         .||| |.....||.||.|.||...:  :|.
  Fly   293 QVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPI--AGQ 355

  Fly   251 K-RTVLFGIISYGAPNCREVT---VFTNVLRYSNWI 282
            | |....||:::|. .|.||.   |:.:|.:...||
  Fly   356 KNRFKSAGIVAWGI-GCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 79/287 (28%)
CG5390NP_609374.1 CLIP_1 64..115 CDD:465709
Tryp_SPc 153..390 CDD:214473 74/279 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.