DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG5390

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:296 Identity:83/296 - (28%)
Similarity:118/296 - (39%) Gaps:94/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QTPVGVREQILGGHN--ADIKLHPWMVQILQR----GYHFCGGSLISSLFVLTAAHC-HSRY--R 93
            |.|.||..:|.|..|  |:....|||:.||:.    ..:.|||:||:...||||||| |::.  .
  Fly   138 QNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSS 202

  Fly    94 LKVRFGRYSGIT--------PRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNY-DIALFLLAKP 149
            :.||.|.:...|        .||               ||.|..|..:.....| |:|:.||..|
  Fly   203 IVVRAGEWDTQTQTEIRRHEDRY---------------VKEIIYHEQFNKGSLYNDVAVMLLESP 252

  Fly   150 --VRYNVQTRPICVLQTSNK-DKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCA 211
              ::.|:||  :|:....:| |..|.:        .|||||.:             |..|.::  
  Fly   253 FTLQENIQT--VCLPNVGDKFDFDRCY--------ATGWGKNK-------------FGKDGEY-- 292

  Fly   212 QIFDRKIGWP-------------------------HICA-GHSQSSTCTGDSGGPLSAELTFSGV 250
            |:..:|:..|                         .||| |.....||.||.|.||...:  :|.
  Fly   293 QVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPI--AGQ 355

  Fly   251 K-RTVLFGIISYGAPNCREVT---VFTNVLRYSNWI 282
            | |....||:::|. .|.||.   |:.:|.:...||
  Fly   356 KNRFKSAGIVAWGI-GCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 79/287 (28%)
Tryp_SPc 47..282 CDD:214473 77/285 (27%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/281 (27%)
Tryp_SPc 153..390 CDD:214473 74/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.