DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG9673

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:261 Identity:67/261 - (25%)
Similarity:113/261 - (43%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSG 103
            :|.|   :||||.:.....:||...:.....|.|.|::||:..:||||||.|..          |
  Fly    24 SPQG---RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSV----------G 75

  Fly   104 ITP--------RYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVRYNVQTRPIC 160
            |||        |....:||..  |..::||.:.:|.||.:: .:|||:..|.:.:.::.:.:.|.
  Fly    76 ITPVDASTLAVRLGTINQYAG--GSIVNVKSVIIHPSYGNF-LHDIAILELDETLVFSDRIQDIA 137

  Fly   161 VLQTSN---KDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPH 222
            :..|::   :|...:..|...:: |.|||:......|...|..:...|.|..|    :.:.|:.:
  Fly   138 LPPTTDEETEDVDAELPNGTPVY-VAGWGELSDGTASYKQQKANYNTLSRSLC----EWEAGYGY 197

  Fly   223 ---ICAGHSQ-SSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNC--REVTVFTNVLRYSNW 281
               :|...:: ...|.||:|..:..:       ..||.|:.|:....|  :...|.|.|..|..|
  Fly   198 ESVVCLSRAEGEGICRGDAGAAVIDD-------DKVLRGLTSFNFGPCGSKYPDVATRVSYYLTW 255

  Fly   282 I 282
            |
  Fly   256 I 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 65/253 (26%)
Tryp_SPc 47..282 CDD:214473 63/251 (25%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 63/252 (25%)
Tryp_SPc 29..259 CDD:238113 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.