DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and HABP2

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:325 Identity:93/325 - (28%)
Similarity:144/325 - (44%) Gaps:88/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KMKWLLVCFILALRSYESLGQDLLDP---------------NCVQTPVGVR--EQILGGHNADIK 56
            |:|| ..|.:.|..:     ||:..|               :|.:|.:..|  ::|.||..:...
Human   265 KVKW-EYCDVSACSA-----QDVAYPEESPTEPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAG 323

  Fly    57 LHPWMVQI---------LQRGYHFCGGSLISSLFVLTAAHC---HSRYRLKVRFGRYSGITPRYL 109
            .|||...:         :.:| |||||:||...:|||||||   .:|: |||..|      .:.|
Human   324 KHPWQASLQSSLPLTISMPQG-HFCGGALIHPCWVLTAAHCTDIKTRH-LKVVLG------DQDL 380

  Fly   110 CSSQYCSPFGPEIDVKRIFLHSSYRDY----HNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKL 170
            ...::   ......|::||.:|.|.:.    || ||||..| |||..:      |.|::      
Human   381 KKEEF---HEQSFRVEKIFKYSHYNERDEIPHN-DIALLKL-KPVDGH------CALES------ 428

  Fly   171 RQFLNYVAM----------FNVTGWGKTESQLTSTILQTTSLFHLDRKFC--AQIFDRKIGWPHI 223
             :::..|.:          .:::|||.||:...|..|....:..:....|  .|::|..|....|
Human   429 -KYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDDSMI 492

  Fly   224 CAGHSQ---SSTCTGDSGGPLSAEL--TFSGVKRTVLFGIISYGAPNCREVTVFTNVLRYSNWIR 283
            |||:.|   ..||.|||||||:.|.  |:      .::||:|:|....:...|:|.|.::.|||:
Human   493 CAGNLQKPGQDTCQGDSGGPLTCEKDGTY------YVYGIVSWGLECGKRPGVYTQVTKFLNWIK 551

  Fly   284  283
            Human   552  551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 82/270 (30%)
Tryp_SPc 47..282 CDD:214473 80/267 (30%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056 5/12 (42%)
Tryp_SPc 314..553 CDD:238113 82/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.