DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and GZMA

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:283 Identity:81/283 - (28%)
Similarity:120/283 - (42%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SYESLGQDL-LDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAA 86
            ||..|...| :..:.:..|..|.|:|:||:.......|:||.:.......|.|:||:..:|||||
Human     4 SYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAA 68

  Fly    87 HCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVR 151
            ||:...|.:|..|.:| ||              .|...|:|.|......|..||.|         
Human    69 HCNLNKRSQVILGAHS-IT--------------REEPTKQIMLVKKEFPYPCYDPA--------- 109

  Fly   152 YNVQTR--PICVLQTSNKDKLRQFLNYV------------AMFNVTGWGKTESQLT-STILQTTS 201
                ||  .:.:||...|.|:.:::..:            .|..|.|||:|.:..: |..|:..:
Human   110 ----TREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVN 170

  Fly   202 LFHLDRKFCAQ----IFDRKIGWPHICAGHSQS--STCTGDSGGPLSAELTFSGVKRTVLFGIIS 260
            :..:|||.|..    .|:..||...:|||..:.  .:|.||||.||..|..|.||   ..||:.:
Human   171 ITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGV---TSFGLEN 232

  Fly   261 -YGAPNCREVTVFTNVLRYSNWI 282
             .|.|....|.:..: .::.|||
Human   233 KCGDPRGPGVYILLS-KKHLNWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 74/258 (29%)
Tryp_SPc 47..282 CDD:214473 72/256 (28%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.