DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and Habp2

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:329 Identity:93/329 - (28%)
Similarity:143/329 - (43%) Gaps:88/329 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KMKW----LLVC--------------FILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADI 55
            |:||    :.||              .::.|..::|.|:..:..:.|       ::|.||..:..
  Rat   263 KVKWEYCNVEVCPESDAANPLGSLQEPVMELPGFDSCGKTEMTEHAV-------KRIYGGFKSTA 320

  Fly    56 KLHPWMVQI---------LQRGYHFCGGSLISSLFVLTAAHC--HSRYRLKVRFGRYSGITPRYL 109
            ..|||.|.:         :.:| ||||||||...:|||||||  .|...|||..|..        
  Rat   321 GKHPWQVSLQTSLPLTTSMPQG-HFCGGSLIHPCWVLTAAHCTDMSTKHLKVVLGDQ-------- 376

  Fly   110 CSSQYCSPFGPEIDVKRIFLHSSYRDY----HNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKL 170
             ..:..........|::|..:|.|.:.    || ||||..| |||..:      |.|::      
  Rat   377 -DLKKTESHEQTFRVEKILKYSQYNERDEIPHN-DIALLKL-KPVGGH------CALES------ 426

  Fly   171 RQFLNYVAM----------FNVTGWGKTESQLTSTILQTTSLFHLDRKFC--AQIFDRKIGWPHI 223
             :::..|.:          .:::|||.||:...|..|....:..:....|  .|::|..|....|
  Rat   427 -KYVKTVCLPSDPFPSGTECHISGWGVTETGEGSRQLLDAKVKLIANALCNSRQLYDHTIDDSMI 490

  Fly   224 CAGHSQ---SSTCTGDSGGPLSAEL--TFSGVKRTVLFGIISYGAPNCREVTVFTNVLRYSNWIR 283
            |||:.|   |.||.|||||||:.|.  |:      .::||:|:|....::..|:|.|.::.|||:
  Rat   491 CAGNLQKPGSDTCQGDSGGPLTCEKDGTY------YVYGIVSWGQECGKKPGVYTQVTKFLNWIK 549

  Fly   284 DIVH 287
            ..:|
  Rat   550 TTMH 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 83/269 (31%)
Tryp_SPc 47..282 CDD:214473 81/266 (30%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056 4/11 (36%)
Tryp_SPc 312..551 CDD:238113 83/269 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.