DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and Gzmk

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:253 Identity:77/253 - (30%)
Similarity:109/253 - (43%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLC 110
            :|:||........|:|..|..||.|.|||.||...:|||||||:||           |.:|..:.
  Rat    25 EIIGGREVQPHSRPFMASIQYRGKHICGGVLIHPQWVLTAAHCYSR-----------GHSPTVVL 78

  Fly   111 SSQYCS---PFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQ 172
            .:...|   |.....::|.....|.::...| ||.|..|......|   :.:.:|...:|     
  Rat    79 GAHSLSKNEPMKQTFEIKEFIPFSGFKSGTN-DIMLIKLRTAAELN---KHVQLLHLRSK----- 134

  Fly   173 FLNYV---AMFNVTGWGKTESQL--TSTILQTTSLFHLDRKFC--AQIFDRK--IGWPHICAG-- 226
              ||:   ....|||||.|:..:  ||..||..::..:.||.|  ...::.|  |....||||  
  Rat   135 --NYIRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITKDMICAGDR 197

  Fly   227 HSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREV-TVFTNVLRYSNWIR 283
            ..:..:|.|||||||..:    ||...::.|....|..|...| |:.|.  :|..||:
  Rat   198 RGEKDSCKGDSGGPLICK----GVFHALVSGGYKCGISNKPGVYTLLTK--KYQTWIK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 77/252 (31%)
Tryp_SPc 47..282 CDD:214473 75/249 (30%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 75/250 (30%)
Tryp_SPc 26..251 CDD:238113 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.