DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG18420

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:277 Identity:87/277 - (31%)
Similarity:130/277 - (46%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVCFILALRSYESLGQ-DLLDPNC-VQTPVGVREQILGGHNADIKLHPWMVQILQRGYHF-CGGS 75
            :...:|.|..:..||. ..||..| .::|:.:..:|:.|..|.....|||..:......| |||:
  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGT 72

  Fly    76 LISSLFVLTAAHCH-SRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY-RDYHN 138
            |||...|||||||. ....:.||.|.|          ::....:..|..|.|.|.|..| .:.|.
  Fly    73 LISRRLVLTAAHCFIPNTTIVVRLGEY----------NRKLKGYREEHQVNRTFQHRFYDPNTHA 127

  Fly   139 YDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLF 203
            .||||..|...|.|....||||::..::   .:..::.:.:...||||:|||...|:.|:|..:.
  Fly   128 NDIALLRLVSNVVYKANIRPICIMWDAS---WKHHIDSIKVLTGTGWGRTESMHDSSELRTLDIS 189

  Fly   204 HLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCRE 268
            ....|.||  |...:. ...|||:..|:.|.||:|||:.|.:.:....|.|..| |:.....|:.
  Fly   190 RQPSKMCA--FGSVLS-NQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVG-IAITNKRCQR 250

  Fly   269 VTVFTNVLRYSNWIRDI 285
            .:|||:|:.:..:||.|
  Fly   251 PSVFTDVMSHIEFIRRI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 78/240 (33%)
Tryp_SPc 47..282 CDD:214473 76/237 (32%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 76/238 (32%)
Tryp_SPc 43..267 CDD:238113 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.