DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG18636

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:277 Identity:103/277 - (37%)
Similarity:136/277 - (49%) Gaps:19/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VCFILALRSYESLGQDLLDPNCVQTPVGVREQ------ILGGHNADIKLHPWMVQILQRGYHF-C 72
            |..||..:...|.....|||.|     |:|.|      |:.||.|.....||||.:......| |
  Fly    12 VGIILMFQLLHSGCSQFLDPAC-----GIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVC 71

  Fly    73 GGSLISSLFVLTAAHCH-SRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY-RD 135
            |||||:...|||||||. :...|..|.|.|.. |....|:..||: |..|..|...|.|..| .:
  Fly    72 GGSLITDKLVLTAAHCFIANQHLVARLGEYER-TRSEECTGYYCN-FREEHMVDAGFKHKLYDPN 134

  Fly   136 YHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTT 200
            .|..|||:..|:|.|.|....|||||:.   ..:.|.:|:.:.:...||||||:.:..|..|||.
  Fly   135 THANDIAILRLSKSVVYRDNIRPICVVW---DHRWRHYLDKIDLLTATGWGKTQMESDSDALQTL 196

  Fly   201 SLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPN 265
            .:.......||:...:.|.....|||:..|:.|.|||||||.|.:|....:|.|..||.||...|
  Fly   197 DIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRN 261

  Fly   266 CREVTVFTNVLRYSNWI 282
            |::.:|||:||.::.:|
  Fly   262 CQKASVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 92/239 (38%)
Tryp_SPc 47..282 CDD:214473 91/237 (38%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 91/238 (38%)
Tryp_SPc 45..278 CDD:238113 91/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.