DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and Prss45

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:314 Identity:91/314 - (28%)
Similarity:137/314 - (43%) Gaps:78/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KWLLVCF--ILALRSYESLG--QDLLDPNCVQTPVGVREQILGGHNADIKLH-PWMVQILQRGYH 70
            :|:|:||  :|.|....:||  ::..:|.| .||       ....|.:...| ||...:.....|
Mouse    17 RWILICFAALLLLPPRPNLGYNENYTEPVC-GTP-------WWPDNLEESHHWPWEASLQIEDKH 73

  Fly    71 FCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGP----EIDVKRIFLHS 131
            .|||:||...:|::||||....:      .||     .:..|....|.|.    :|.|..|.:|.
Mouse    74 VCGGALIDRSWVVSAAHCIQGNK------EYS-----VMLGSSTLHPNGSSWTLKIPVGDIIIHP 127

  Fly   132 SY--RDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFN--------VTGWG 186
            .|  |::...||||..|..||.:|...:|||:.:.:              ||        |||||
Mouse   128 KYWGRNFIRSDIALLCLETPVTFNKYVQPICLPEHN--------------FNFKVGTKCWVTGWG 178

  Fly   187 K----TESQLT-STILQTTSLFHLDRKFCAQIFDRKIGWPH---------ICAGHSQSSTCTGDS 237
            :    :.:||| :..|....:|.:|.|.|..||.:|..:|.         ||..:.....|.||.
Mouse   179 QVKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLCYGDP 243

  Fly   238 GGPLSAELTFSGVKRTVLFGIISY-----GAPNCREVTVFTNVLRYSNWIRDIV 286
            ||||:.|:.    .|.:|.|:.|:     ..||   ::|:|.:.:|:.||:|.|
Mouse   244 GGPLACEID----GRWILAGVFSWEKACATVPN---LSVYTRITKYTIWIKDQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 77/271 (28%)
Tryp_SPc 47..282 CDD:214473 75/268 (28%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 76/261 (29%)
Tryp_SPc 59..286 CDD:214473 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.