DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and mst1

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_694512.1 Gene:mst1 / 259260 ZFINID:ZDB-GENE-020806-3 Length:709 Species:Danio rerio


Alignment Length:253 Identity:66/253 - (26%)
Similarity:108/253 - (42%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 REQILGGHNADIKLHPWMVQILQR-GYHFCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPR 107
            |.:|:||...:   .||.|.:..| |.|||||||:||.:|::...|.|...:.:     :|.|. 
Zfish   479 RLRIVGGTPGN---SPWTVSLRDRKGNHFCGGSLVSSEWVISTKQCFSSCYVDL-----TGYTA- 534

  Fly   108 YLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQ 172
             :..:.:..|...|.|::||.|...........:.:..|..|.::|.:...||:      ...|.
Zfish   535 -MMGTLFRDPKEGEPDLQRISLTKIVCGPSESHLVMLQLETPAQFNERVSQICL------PPERY 592

  Fly   173 FLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQS--STCTG 235
            .:....:..:.|||:|:.:...|:|....:..|..|.|.|.|..::....:|....|:  ..|..
Zfish   593 IVPDGTICEIAGWGETKGKGDETVLNVAQMPVLSNKDCNQYFKGRVRENEMCTMAFQAGVGACER 657

  Fly   236 DSGGPLSAELTFSGVKRTVLFGII-------SYGAPNCREVTVFTNVLRYSNWIRDIV 286
            |.||||:.:    .....||.|:|       ..|.||     :|..|..|.:||:.::
Zfish   658 DYGGPLACQ----NSDCWVLEGVIIPMRRCGHAGQPN-----IFIRVSVYVDWIKKVM 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 65/247 (26%)
Tryp_SPc 47..282 CDD:214473 63/244 (26%)
mst1NP_694512.1 PAN_AP_HGF 24..105 CDD:238532
KR 109..187 CDD:238056
KR 192..271 CDD:214527
KR 284..365 CDD:214527
KR 370..451 CDD:238056
Tryp_SPc 481..702 CDD:214473 63/245 (26%)
Tryp_SPc 482..705 CDD:238113 65/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.